Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVR AFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQ SWTISVTTPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLK NEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSKDK QVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVP ILRQWLTGRGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGG RLLIDEYYNEEGLQNGEGQRGRIWKCCEDGTLELTDSNTKYVGNNISTKG VGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETA SPLYLLLKAPSSLPLRGDAQISVTLVNHSEQEKAVQLAIGVQAVHYNGVL AAKLWRKKLHLTLSANLEKIITIGLFFSNFERNPPENTFLRLTAMATHSE SNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPMEDCV ISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNM FQNLTNYKSVTVVAPELSA
    • Amino acids
      1 to 619
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158366 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPB42
    • EPB42_HUMAN
    • Erythrocyte membrane protein band 4.2
    • Erythrocyte protein 4.2
    • Erythrocyte surface protein band 4.2
    • MGC116735
    • MGC116737
    • P4.2
    • PA
    • SPH5
    see all
  • Function
    Probably plays an important role in the regulation of erythrocyte shape and mechanical properties.
  • Involvement in disease
    Defects in EPB42 are the cause of spherocytosis type 5 (SPH5) [MIM:612690]; also known as hereditary spherocytosis type 5 (HS5). Spherocytosis is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal. Absence of band 4.2 associated with spur or target erythrocytes has also been reported.
  • Sequence similarities
    Belongs to the transglutaminase superfamily. Transglutaminase family.
  • Post-translational
    modifications
    Both cAMP-dependent kinase (CAPK) and another kinase present in the red-blood cells seem to be able to phosphorylate EPB42.
  • Cellular localization
    Cell membrane. Cytoplasm > cytoskeleton. Cytoplasmic surface of erythrocyte membranes.
  • Information by UniProt

Images

  • ab158366 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158366 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158366.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up