Recombinant Human EPB4IL2 protein (ab158365)

Overview

  • Product name
    Recombinant Human EPB4IL2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPP PAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKK EPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSV SKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKEVQTN ELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEKHAKGQVLFDKVCEH LNLLEKDYFGLLFQESPEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPPD PSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDP EEHGSIDLSEFQFAPTQTKELEEKVAELHKTHRGLSPAQADSQFLENAKR LSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISY KRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSP EQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRVSRS LDGAPIGVMDQSLMKDFPGAAGEISAYGPGLVSIAVVQDGDGRREVRSPT KAPHLQLIEGKSSHETLNIVEEKSGQRLGKTKE
    • Amino acids
      1 to 633
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4.1 G
    • 4.1G
    • AW555191
    • Band 4.1 like protein 2
    • Band 4.1-like protein 2
    • D10Ertd398e
    • DKFZp781D1972
    • DKFZp781H1755
    • E41L2_HUMAN
    • Epb41l2
    • Erythrocyte membrane protein band 4.1 like 2
    • Erythrocyte membrane protein band 4.1 like protein 2
    • Generally expressed protein 4.1
    • NBL2
    • OTTHUMP00000017197
    • OTTHUMP00000040262
    see all
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 1 FERM domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab158365 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up