Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEM NGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAG VRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTR YQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGE SLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
    • Molecular weight
      54 kDa including tags
    • Amino acids
      24 to 265
    • Additional sequence information
      C-terminal human IgG1 Fc tag

Specifications

Our Abpromise guarantee covers the use of ab155712 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by the ability of the immobilized protein to support the adhesion of the L Cells mouse fibroblast cell line. When 5×104 cells/well are added to ab155712 and Human Fibronectin 0.5 µg/ml coated plates, cell adhesion is enhanced in a dose dependent manner after 45 minutes at 37°C. The ED50 for this effect is typically 0.5-2.9 µg/mL. Measured by its binding ability in a functional ELISA. The activity of this protein is measured in a homophilic binding assay.

    Please kindly note that this reconstitution instruction below MUST be followed to ensure successful reconstitution, and any improper handling will lead to loss or destroy of the activity. Avoid vigorous shaking or vortexing.

  • Applications

    ELISA

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Additional notes

    In DTT-reduced SDS-PAGE, ab155712 migrates as 60-65 kDa poly peptide due to glycosylation.

    Before opening, centrifuge each vial for 20-30 seconds at 10,000g RCF to recover protein powder to the bottom of the vial

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is strongly recommended to reconstitute the lyophilized protein with 1000 µl sterile PBS, pH7.4 to a stock solution of 100 µg/ml. Solubilize for 30-60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • 17 1A
    • 323/A3
    • Adenocarcinoma associated antigen
    • Adenocarcinoma-associated antigen
    • Antigen identified by monoclonal antibody AUA1
    • AUA1
    • CD326
    • CD326 antigen
    • Cell surface glycoprotein Trop 1
    • Cell surface glycoprotein Trop 2
    • Cell surface glycoprotein Trop-1
    • CO 17A
    • CO17 1A
    • CO17A
    • DIAR5
    • EGP
    • EGP 2
    • EGP2
    • EGP314
    • EGP40
    • Ep CAM
    • Ep-CAM
    • EPCAM
    • EPCAM_HUMAN
    • EpCAM1
    • Epithelial cell adhesion molecule
    • Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD)
    • Epithelial cell surface antigen
    • Epithelial cellular adhesion molecule
    • Epithelial glycoprotein
    • Epithelial glycoprotein 1
    • Epithelial glycoprotein 314
    • ESA
    • GA733 1
    • GA733 2
    • GA733-2
    • gastrointestinal tumor-associated antigen 2, 35-KD glycoprotein
    • gp4
    • hEGP 2
    • hEGP314
    • HNPCC8
    • Human epithelial glycoprotein 2
    • KS 1/4 antigen
    • KS1/4
    • KSA
    • Ly74
    • Lymphocyte antigen 74
    • M1S 1
    • M1S2
    • M4S1
    • Major gastrointestinal tumor associated protein GA733 2
    • Major gastrointestinal tumor-associated protein GA733-2
    • mEGP314
    • Membrane component chromosome 4 surface marker (35kD glycoprotein)
    • Membrane component, chromosome 4, surface marker
    • Membrane component, chromosome 4, surface marker 1
    • MIC18
    • MK 1
    • Protein 289A
    • TACD1
    • TACSTD1
    • TROP1
    • Tumor associated calcium signal transducer 1
    • Tumor associated calcium signal transducer 2 precursor
    • Tumor-associated calcium signal transducer 1
    see all
  • Function
    May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
  • Tissue specificity
    Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.
  • Involvement in disease
    Defects in EPCAM are the cause of diarrhea type 5 (DIAR5) [MIM:613217]. It is an intractable diarrhea of infancy characterized by villous atrophy and absence of inflammation, with intestinal epithelial cell dysplasia manifesting as focal epithelial tufts in the duodenum and jejunum.
    Defects in EPCAM are a cause of hereditary non-polyposis colorectal cancer type 8 (HNPCC8) [MIM:613244]. HNPCC is a disease associated with marked increase in cancer susceptibility. It is characterized by a familial predisposition to early-onset colorectal carcinoma (CRC) and extra-colonic tumors of the gastrointestinal, urological and female reproductive tracts. HNPCC is reported to be the most common form of inherited colorectal cancer in the Western world. Clinically, HNPCC is often divided into two subgroups. Type I is characterized by hereditary predisposition to colorectal cancer, a young age of onset, and carcinoma observed in the proximal colon. Type II is characterized by increased risk for cancers in certain tissues such as the uterus, ovary, breast, stomach, small intestine, skin, and larynx in addition to the colon. Diagnosis of classical HNPCC is based on the Amsterdam criteria: 3 or more relatives affected by colorectal cancer, one a first degree relative of the other two; 2 or more generation affected; 1 or more colorectal cancers presenting before 50 years of age; exclusion of hereditary polyposis syndromes. The term 'suspected HNPCC' or 'incomplete HNPCC' can be used to describe families who do not or only partially fulfill the Amsterdam criteria, but in whom a genetic basis for colon cancer is strongly suspected. Note=HNPCC8 results from heterozygous deletion of 3-prime exons of EPCAM and intergenic regions directly upstream of MSH2, resulting in transcriptional read-through and epigenetic silencing of MSH2 in tissues expressing EPCAM.
  • Sequence similarities
    Belongs to the EPCAM family.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications
    Hyperglycosylated in carcinoma tissue as compared with autologous normal epithelia. Glycosylation at Asn-198 is crucial for protein stability.
  • Cellular localization
    Lateral cell membrane. Cell junction > tight junction. Co-localizes with CLDN7 at the lateral cell membrane and tight junction.
  • Information by UniProt

Images

  • SDS-PAGE of reduced ab155712 stained overnight with Coomassie Blue.

References

ab155712 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155712.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up