Recombinant Human Eph receptor A3 protein (ab158370)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWL VPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGS MNCRCENNYFRADKDPPSMACTRPP
    • Amino acids
      202 to 326
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158370 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW492086
    • Cek4
    • EC 2.7.10.1
    • EK4
    • End3
    • Eph receptor A3
    • EPH-like kinase 4
    • EPH-like tyrosine kinase 1
    • EPHA3
    • EPHA3_HUMAN
    • Ephrin receptor EphA3
    • Ephrin type-A receptor 3
    • ETK
    • ETK 1
    • ETK1
    • HEK
    • HEK 4
    • HEK4
    • Human embryo kinase
    • Human embryo kinase 1
    • Mek4
    • MGC109882
    • Receptor tyrosine kinase HEK
    • Testicular tissue protein Li 64
    • Tyro 4
    • Tyro4
    • TYRO4 protein tyrosine kinase
    • Tyrosine protein kinase receptor ETK 1
    • Tyrosine-protein kinase receptor ETK1
    • Tyrosine-protein kinase TYRO4
    see all
  • Function
    Receptor for members of the ephrin-A family. Binds to ephrin-A2, -A3, -A4 and -A5. Could play a role in lymphoid function.
  • Tissue specificity
    Widely expressed. Highest level in placenta.
  • Involvement in disease
    Defects in EPHA3 may be a cause of colorectal cancer (CRC) [MIM:114500].
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab158370 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158370 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158370.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up