Recombinant Human Eph receptor A7 protein (ab114687)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISS PPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFV ELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIA ADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKV YYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHC SAEGEWLVPIGKCICKAGYQQKGDTCECK
    • Molecular weight
      56 kDa including tags
    • Amino acids
      1 to 279

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cek 11
    • Developmental kinase 1
    • EBK
    • EHK-3
    • EHK3
    • EK11
    • Embryonic brain kinase
    • EPH homology kinase 3
    • EPH-like kinase 11
    • Epha7
    • EPHA7_HUMAN
    • Ephrin receptor Eph A7
    • Ephrin type A receptor 7
    • Ephrin type-A receptor 7
    • hEK11
    • MDK 1
    • Receptor protein tyrosine kinase HEK 11
    • Tyrosine protein kinase receptor EHK 3
    see all
  • Function
    Receptor for members of the ephrin-A family. Binds to ephrin-A1, -A2, -A3, -A4 and -A5.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114687 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114687 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up