Recombinant Human Eph receptor A7 protein (ab114687)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15375-3
    • SpeciesHuman
    • SequenceMVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISS PPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFV ELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIA ADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKV YYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHC SAEGEWLVPIGKCICKAGYQQKGDTCECK
    • Molecular weight56 kDa including tags
    • Amino acids1 to 279

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114687 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cek 11
    • Developmental kinase 1
    • EBK
    • EHK-3
    • EHK3
    • EK11
    • Embryonic brain kinase
    • EPH homology kinase 3
    • EPH-like kinase 11
    • Epha7
    • EPHA7_HUMAN
    • Ephrin receptor Eph A7
    • Ephrin type A receptor 7
    • Ephrin type-A receptor 7
    • hEK11
    • MDK 1
    • Receptor protein tyrosine kinase HEK 11
    • Tyrosine protein kinase receptor EHK 3
    see all
  • FunctionReceptor for members of the ephrin-A family. Binds to ephrin-A1, -A2, -A3, -A4 and -A5.
  • Tissue specificityWidely expressed.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Eph receptor A7 protein images

  • ab114687 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Eph receptor A7 protein (ab114687)

ab114687 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114687.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"