Recombinant Human Eph receptor B2 protein (ab158375)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSG TFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP
    • Amino acids
      226 to 325
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158375 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • cek5
    • Developmentally regulated EPH related tyrosine kinase
    • DRT
    • EK5
    • ELK related protein tyrosine kinase
    • Eph receptor B2
    • EPH tyrosine kinase 3
    • EPH-like kinase 5
    • EPHB2
    • EPHB2_HUMAN
    • Ephrin type B receptor 2
    • Ephrin type-B receptor 2
    • EPHT 3
    • ERK
    • ETECK
    • hEK5
    • Nuk
    • Prkm 5
    • Receptor protein tyrosine kinase HEK 5
    • Renal carcinoma antigen NY-REN-47
    • Sek 3
    • Tyro 5
    • Tyrosine protein kinase receptor CEK 5
    • Tyrosine protein kinase receptor EPH 3
    • Tyrosine protein kinase receptor QEK 5
    • Tyrosine-protein kinase receptor EPH-3
    • Tyrosine-protein kinase TYRO5
    see all
  • Function
    Receptor for members of the ephrin-B family. Phosphorylates ARHGEF15, leading to its ubiquitination and degradation by the proteasome which promotes EFNB1-dependent synapse formation. Can function in aspects of retinal ganglion cell axon guidance to the optic disk even when lacking its tyrosine kinase domain. Acts as a tumor suppressor.
  • Tissue specificity
    Brain, heart, lung, kidney, placenta, pancreas, liver and skeletal muscle. Preferentially expressed in fetal brain.
  • Involvement in disease
    Defects in EPHB2 may be a cause of susceptibility to prostate cancer (PC) [MIM:176807]. It is a malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma. Note=EPHB2 mutations have been found in a prostate cancer cell line derived from a brain metastasis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158375 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158375 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158375.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up