Recombinant Human Eph receptor B3 protein (ab158376)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVS AGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ
    • Amino acids
      899 to 997
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cek10
    • EK2
    • Embryonic kinase 2
    • EPH Like Tyrosine Kinase 2
    • EPH receptor B3
    • EPH-like kinase 2
    • ephb3
    • EPHB3_HUMAN
    • Ephrin receptor EphB3
    • Ephrin type B receptor 3
    • Ephrin type-B receptor 3
    • ETK2
    • hEK2
    • Human Embryo Kinase 2
    • Mdk5
    • Sek4
    • TYRO6
    • Tyrosine protein kinase receptor HEK2
    • Tyrosine protein kinase TYRO6
    • Tyrosine-protein kinase TYRO6
    see all
  • Function
    Receptor for members of the ephrin-B family. Binds to ephrin-B1 and -B2.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158376 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up