Recombinant human Eph receptor B4 protein (ab167746)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRA PGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYY ESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRL GPLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELV VPVAGSCVVDAVPAPGPSPSLYCREDGQWAEQPVTGCSCAPGFEAAEGNT KCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRVGYFRARTDPR GAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALRCRECRP GGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLA TGPVPFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLD YEVKYHEKGAEGPSSVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYG PFGQEHHSQTQLDESEGWREQLA
    • Molecular weight
      58 kDa including tags
    • Amino acids
      17 to 539
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its binding ability in a functional ELISA. Immobilized rhEph receptor B4 at 2 µg/ml (100 µl/well) can bind Human EphrinB2 with a linear range of 0.8 - 85 ng/ml.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 97 % SDS-PAGE.
    ab167746 was lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Measured by its binding ability in a functional ELISA. Immobilized rhEph receptor B4 at 2 µg/ml (100 µl/well) can bind Human EphrinB2 with a linear range of 0.8 - 85 ng/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Ephb4
    • EPHB4_HUMAN
    • Ephrin receptor EphB4
    • Ephrin type-B receptor 4
    • Hepatoma Transmembrane Kinase
    • HTK
    • MYK 1
    • MYK1
    • TYRO 11
    • TYRO11
    • Tyrosine-protein kinase receptor HTK
    • Tyrosine-protein kinase TYRO11
    see all
  • Function
    Receptor for members of the ephrin-B family. Binds to ephrin-B2. May have a role in events mediating differentiation and development.
  • Tissue specificity
    Abundantly expressed in placenta and in a range of primary tissues and malignant cell lines. Expressed in fetal, but not adult, brain, and in primitive and myeloid, but not lymphoid, hematopoietic cells.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab167746 and staining overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 65-70 kDa polypeptide in SDS-PAGE.

References

ab167746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up