Recombinant Human EPHA10 protein (ab166184)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      METCAGPHPLRLFLCRMQLCLALLLGPWRPGTAEEVILLDSKASQAELGW TALPSNGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQR IFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGRGRPRLGGSRPR KIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVA LVSVRVYYKQCRATVRGLATFPATAAESAFSTLVEVAGTCVAHSEGEPGS PPRMHCGADGEWLVPVGRCSCSAGFQERGDFCEGIQLAGGRGVGV
    • Amino acids
      1 to 295
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPH receptor A10
    • EPHA 10
    • Epha10
    • EphA10s protein
    • EPHAA_HUMAN
    • Ephrin type A receptor 10
    • Ephrin type-A receptor 10
    • FLJ16103
    • FLJ33655
    • MGC43817
    see all
  • Function
    Receptor for members of the ephrin-A family. Binds to EFNA3, EFNA4 and EFNA5.
  • Tissue specificity
    Mainly expressed in testis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab166184 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up