Recombinant Human Ephrin A1 protein (denatured) (ab113867)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP20827
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDRHTVFWNSSNPKFRNEDYTIHVQLNDYV DIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSA KHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTV SGKITHSPQAHVNPQEKRLAADDPEVRVLHSIGHS
    • Molecular weight22 kDa including tags
    • Amino acids19 to 182
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names
    • B61
    • ECKLG
    • EFL 1
    • EFL1
    • EFNA 1
    • Efna1
    • EFNA1_HUMAN
    • EPH related receptor tyrosine kinase ligand 1
    • EPH-related receptor tyrosine kinase ligand 1
    • Ephrin-A1
    • Ephrin-A1, secreted form
    • EphrinA1
    • EPLG 1
    • EPLG1
    • Immediate early response protein B61
    • LERK 1
    • LERK-1
    • LERK1
    • Ligand of eph related kinase 1
    • OTTHUMP00000033242
    • OTTHUMP00000033271
    • secreted form
    • TNF alpha-induced protein 4
    • TNFAIP 4
    • TNFAIP4
    • Tumor necrosis factor alpha induced protein 4
    • Tumor necrosis factor alpha-induced protein 4
    see all
  • FunctionPlays an important role in angiogenesis and tumor neovascularization. The recruitement of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly (By similarity). Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cones.
  • Tissue specificityBrain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level).
  • Sequence similaritiesBelongs to the ephrin family.
  • Post-translational
    modifications
    Undergo proteolysis by a metalloprotease to give rise to a soluble monomeric form.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Recombinant Human Ephrin A1 protein (denatured) images

  • 15% SDS PAGE analysis of 3 µg ab113867.

References for Recombinant Human Ephrin A1 protein (denatured) (ab113867)

ab113867 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"