Recombinant Human Ephrin A1 protein (denatured) (ab113867)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDRHTVFWNSSNPKFRNEDYTIHVQLNDYV DIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSA KHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTV SGKITHSPQAHVNPQEKRLAADDPEVRVLHSIGHS
    • Molecular weight
      22 kDa including tags
    • Amino acids
      19 to 182
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names
    • B61
    • ECKLG
    • EFL 1
    • EFL1
    • EFNA 1
    • Efna1
    • EFNA1_HUMAN
    • EPH related receptor tyrosine kinase ligand 1
    • EPH-related receptor tyrosine kinase ligand 1
    • Ephrin-A1
    • Ephrin-A1, secreted form
    • EphrinA1
    • EPLG 1
    • EPLG1
    • Immediate early response protein B61
    • LERK 1
    • LERK-1
    • LERK1
    • Ligand of eph related kinase 1
    • OTTHUMP00000033242
    • OTTHUMP00000033271
    • secreted form
    • TNF alpha-induced protein 4
    • TNFAIP 4
    • TNFAIP4
    • Tumor necrosis factor alpha induced protein 4
    • Tumor necrosis factor alpha-induced protein 4
    see all
  • Function
    Plays an important role in angiogenesis and tumor neovascularization. The recruitement of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly (By similarity). Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cones.
  • Tissue specificity
    Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level).
  • Sequence similarities
    Belongs to the ephrin family.
  • Post-translational
    modifications
    Undergo proteolysis by a metalloprotease to give rise to a soluble monomeric form.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 15% SDS PAGE analysis of 3 µg ab113867.

References

ab113867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up