Recombinant Human Ephrin A2 protein (ab114898)

Overview

  • Product nameRecombinant Human Ephrin A2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO43921
    • SpeciesHuman
    • SequenceMAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHA GAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHA SCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYY ISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS
    • Molecular weight50 kDa including tags
    • Amino acids1 to 213

Specifications

Our Abpromise guarantee covers the use of ab114898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EFNA 2
    • efna2
    • EFNA2_HUMAN
    • ELF1
    • Eph related receptor tyrosine kinase ligand 6
    • EPH-related receptor tyrosine kinase ligand 6
    • Ephrin-A2
    • EphrinA2
    • EPLG6
    • HEK7 L
    • HEK7 ligand
    • HEK7-L
    • HEK7L
    • LERK 6
    • LERK-6
    • LERK6
    • Ligand of eph related kinase 6
    see all
  • Sequence similaritiesBelongs to the ephrin family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Ephrin A2 protein images

  • 12.5% SDS-PAGE showing ab114898 at approximately 50.43kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Ephrin A2 protein (ab114898)

ab114898 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

I can confirm that this protein does contain Tris HCL which is harmful for living cells so this product may not be suitable for functional assays.

I hope this information is helpful to you. Please do not h...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"