Recombinant Human Ephrin A3 protein (ab114662)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRN GYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEY Y
    • Molecular weight
      37 kDa
    • Amino acids
      45 to 145

Specifications

Our Abpromise guarantee covers the use of ab114662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein. Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EFL 2
    • EFL-2
    • EFL2
    • EFN A3
    • EFNA 3
    • Efna3
    • EFNA3_HUMAN
    • EHK1 L
    • EHK1 ligand
    • EHK1-L
    • EHK1L
    • EPH related receptor tyrosine kinase ligand 3
    • EPH-related receptor tyrosine kinase ligand 3
    • Ephrin-A3
    • EphrinA3
    • EPLG 3
    • EPLG3
    • LERK 3
    • LERK-3
    • LERK3
    • Ligand of eph related kinase 3
    see all
  • Tissue specificity
    Expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the ephrin family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114662 on a 12.5% gel stained with Coomassie Blue.

References

ab114662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up