Recombinant Human Ephrin A3 protein (ab114662)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP52797
    • SpeciesHuman
    • SequenceRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRN GYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEY Y
    • Molecular weight37 kDa
    • Amino acids45 to 145

Specifications

Our Abpromise guarantee covers the use of ab114662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein. Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EFL 2
    • EFL-2
    • EFL2
    • EFN A3
    • EFNA 3
    • Efna3
    • EFNA3_HUMAN
    • EHK1 L
    • EHK1 ligand
    • EHK1-L
    • EHK1L
    • EPH related receptor tyrosine kinase ligand 3
    • EPH-related receptor tyrosine kinase ligand 3
    • Ephrin-A3
    • EphrinA3
    • EPLG 3
    • EPLG3
    • LERK 3
    • LERK-3
    • LERK3
    • Ligand of eph related kinase 3
    see all
  • Tissue specificityExpressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the ephrin family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Ephrin A3 protein images

  • SDS-PAGE analysis of ab114662 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Ephrin A3 protein (ab114662)

ab114662 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"