Recombinant Human Ephrin A3 protein (ab151805)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVG PGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKF SEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSH SGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSVDHHHHHH
    • Molecular weight
      22 kDa including tags
    • Amino acids
      23 to 211
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • EFL 2
    • EFL-2
    • EFL2
    • EFN A3
    • EFNA 3
    • Efna3
    • EFNA3_HUMAN
    • EHK1 L
    • EHK1 ligand
    • EHK1-L
    • EHK1L
    • EPH related receptor tyrosine kinase ligand 3
    • EPH-related receptor tyrosine kinase ligand 3
    • Ephrin-A3
    • EphrinA3
    • EPLG 3
    • EPLG3
    • LERK 3
    • LERK-3
    • LERK3
    • Ligand of eph related kinase 3
    see all
  • Tissue specificity
    Expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the ephrin family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

References

ab151805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up