Recombinant Human Ephrin A4 protein (His tag) (ab215611)

Overview

Description

  • Nature
    Recombinant
  • Source
    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFAL YMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFL PGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGVDHH HHHH
    • Molecular weight
      17 kDa including tags
    • Amino acids
      26 to 171
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Full length mature protein without signal peptide and without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab215611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

  • Reconstitution
    Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • EFL 4
    • EFL4
    • EFN A4
    • EFNA 4
    • EFNA4
    • EFNA4_HUMAN
    • Eph related receptor tyrosine kinase ligand 4
    • EPH-related receptor tyrosine kinase ligand 4
    • Ephrin-A4
    • EphrinA4
    • EPLG 4
    • EPLG4
    • LERK 4
    • LERK-4
    • LERK4
    • Ligand of Eph related kinase 4
    • MGC125826
    see all
  • Function
    May play a role in the interaction between activated B lymphocytes and dendritic cells in tonsils.
  • Tissue specificity
    Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines.
  • Sequence similarities
    Belongs to the ephrin family.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • Lane 1 - Reduced

    Lane 2 - Non-reduced

References

ab215611 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up