Recombinant Human Ephrin A5 protein (ab114463)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNS CMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
    • Molecular weight
      36 kDa including tags
    • Amino acids
      114 to 203
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114463 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • EPLG7
    • AF1
    • AL 1
    • AL-1
    • EFL5
    • Efna5
    • EFNA5_HUMAN
    • EPH-related receptor tyrosine kinase ligand 7
    • Ephrin A5
    • Ephrin-A5
    • EPLG7
    • GLC1M
    • LERK-7
    • LERK7
    • RAGS
    see all
  • Function
    May function actively to stimulate axon fasciculation. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase.
  • Sequence similarities
    Belongs to the ephrin family.
  • Cellular localization
    Cell membrane. Membrane > caveola. Compartmentalized in discrete caveolae-like membrane microdomains.
  • Information by UniProt

Images

  • ab114463 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up