Recombinant Human Ephrin A5 protein (ab114463)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP52803
    • SpeciesHuman
    • SequenceFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNS CMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
    • Molecular weight36 kDa including tags
    • Amino acids114 to 203
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114463 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • EPLG7
    • AF1
    • AL 1
    • AL-1
    • EFL5
    • Efna5
    • EFNA5_HUMAN
    • EPH-related receptor tyrosine kinase ligand 7
    • Ephrin A5
    • Ephrin-A5
    • EPLG7
    • GLC1M
    • LERK-7
    • LERK7
    • RAGS
    see all
  • FunctionMay function actively to stimulate axon fasciculation. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase.
  • Sequence similaritiesBelongs to the ephrin family.
  • Cellular localizationCell membrane. Membrane > caveola. Compartmentalized in discrete caveolae-like membrane microdomains.
  • Information by UniProt

Recombinant Human Ephrin A5 protein images

  • ab114463 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human Ephrin A5 protein (ab114463)

ab114463 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"