Recombinant Human Ephrin B1 protein (ab192282)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYK LYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFK KHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLT TSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSS GDPDGVDHHHHHH
    • Molecular weight
      23 kDa including tags
    • Amino acids
      28 to 232
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab192282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Reconstitute for long term storage.

  • Reconstitution
    Lyophilized protein should be stored at < -20°C.

General Info

  • Alternative names
    • CFND
    • CFNS
    • Craniofrontonasal syndrome (craniofrontonasal dysplasia)
    • EFL 3
    • EFL-3
    • EFL3
    • EFNB1
    • EFNB1_HUMAN
    • Elk L
    • ELK ligand
    • ELK-L
    • Eph related receptor tyrosine kinase ligand 2
    • EPH-related receptor tyrosine kinase ligand 2
    • Ephrin-B1
    • EPLG2
    • LERK 2
    • LERK-2
    • LERK2
    • Ligand of eph related kinase 2
    • MGC8782
    see all
  • Function
    Binds to the receptor tyrosine kinases EPHB1 and EPHA1. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
  • Tissue specificity
    Heart, placenta, lung, liver, skeletal muscle, kidney, pancreas.
  • Involvement in disease
    Defects in EFNB1 are a cause of craniofrontonasal syndrome (CFNS) [MIM:304110]; also known as craniofrontonasal dysplasia (CFND). CFNS is an X-linked inherited syndrome characterized by hypertelorism, coronal synostosis with brachycephaly, downslanting palpebral fissures, clefting of the nasal tip, joint anomalies, longitudinally grooved fingernails and other digital anomalies.
  • Sequence similarities
    Belongs to the ephrin family.
  • Post-translational
    modifications
    Inducible phosphorylation of tyrosine residues in the cytoplasmic domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab192282 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up