Recombinant Human Ephrin B1 protein (denatured) (ab111630)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP98172
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMLAKNLEPVSWSSLNPKFLSGKGLVIYPKI GDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQ EIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTR TMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSD GKHETVNQEEKSGPGASGGSSGDPDGFFNSK
    • Molecular weight25 kDa including tags
    • Amino acids28 to 237
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 5% Glycerol, 2.4% Urea

General Info

  • Alternative names
    • CFND
    • CFNS
    • Craniofrontonasal syndrome (craniofrontonasal dysplasia)
    • EFL 3
    • EFL-3
    • EFL3
    • EFNB1
    • EFNB1_HUMAN
    • Elk L
    • ELK ligand
    • ELK-L
    • Eph related receptor tyrosine kinase ligand 2
    • EPH-related receptor tyrosine kinase ligand 2
    • Ephrin-B1
    • EPLG2
    • LERK 2
    • LERK-2
    • LERK2
    • Ligand of eph related kinase 2
    • MGC8782
    see all
  • FunctionBinds to the receptor tyrosine kinases EPHB1 and EPHA1. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
  • Tissue specificityHeart, placenta, lung, liver, skeletal muscle, kidney, pancreas.
  • Involvement in diseaseDefects in EFNB1 are a cause of craniofrontonasal syndrome (CFNS) [MIM:304110]; also known as craniofrontonasal dysplasia (CFND). CFNS is an X-linked inherited syndrome characterized by hypertelorism, coronal synostosis with brachycephaly, downslanting palpebral fissures, clefting of the nasal tip, joint anomalies, longitudinally grooved fingernails and other digital anomalies.
  • Sequence similaritiesBelongs to the ephrin family.
  • Post-translational
    modifications
    Inducible phosphorylation of tyrosine residues in the cytoplasmic domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Ephrin B1 protein (denatured) images

  • 15% SDS-PAGE showing ab111630 at approximately 25.3kDa (3µg).

References for Recombinant Human Ephrin B1 protein (denatured) (ab111630)

ab111630 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"