Recombinant Human Ephrin B2 protein (ab113609)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP52799
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMIVLEPIYWNSSNSKFLPGQGLVLYP QIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCA KPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGV CQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKP NPGSSTDGNSAGHSGNNILGSEVALFA
    • Molecular weight25 kDa including tags
    • Amino acids28 to 229
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113609 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab113609 was purified to > 85% by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • EFN B2
    • EFNB 2
    • Efnb2
    • EFNB2_HUMAN
    • Eph related receptor tyrosine kinase ligand 5
    • EPH-related receptor tyrosine kinase ligand 5
    • ephrin B2
    • Ephrin-B2
    • EphrinB2
    • EPLG 5
    • EPLG5
    • Htk L
    • HTK ligand
    • HTK-L
    • HTKL
    • LERK 5
    • LERK-5
    • LERK5
    • Ligand of eph related kinase 5
    • MGC126226
    • MGC126227
    • MGC126228
    • OTTMUSP00000024973
    see all
  • FunctionCell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Binds to receptor tyrosine kinase including EPHA4, EPHA3 and EPHB4. Together with EPHB4 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells. May play a role in constraining the orientation of longitudinally projecting axons.
    (Microbial infection) Acts as a receptor for Hendra virus and Nipah virus.
  • Tissue specificityLung and kidney.
  • Sequence similaritiesBelongs to the ephrin family.
    Contains 1 ephrin RBD (ephrin receptor-binding) domain.
  • Post-translational
    modifications
    Inducible phosphorylation of tyrosine residues in the cytoplasmic domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Ephrin B2 protein images

  • 15% SDS-PAGE analysis of ab113609 (3µg)

References for Recombinant Human Ephrin B2 protein (ab113609)

ab113609 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113609.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"