Recombinant Human Epiphycan protein (ab158321)

Overview

  • Product name
    Recombinant Human Epiphycan protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      APTLESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNREL LTPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCL LCTCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLSDL KRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDIS NNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNN ILEMHEDTFCNVKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVG SLV
    • Amino acids
      20 to 322
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dermatan sulfate proteoglycan 3
    • DSPG3
    • Epiphycan
    • epiphycan proteoglycan
    • EPYC
    • EPYC_HUMAN
    • Pg Lb
    • PG-Lb
    • PGLB
    • Proteoglycan-Lb
    • SLRR3B
    • Small chondroitin/dermatan sulfate proteoglycan
    see all
  • Function
    May have a role in bone formation and also in establishing the ordered structure of cartilage through matrix organization.
  • Tissue specificity
    Cartilage, ligament, and placenta.
  • Sequence similarities
    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class III subfamily.
    Contains 6 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications
    The O-linked polysaccharides on Thr-60 and Ser-96 are probably the mucin type linked to GalNAc. There is one glycosaminoglycan chain, known to be dermatan sulfate, and it is probably the O-glycosylation at Ser-64.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab158321 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up