Recombinant Human epithelial Sodium Channel gamma protein (ab159483)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGK QPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQ
    • Amino acids
      101 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amiloride sensitive epithelial sodium channel gamma subunit
    • Amiloride sensitive sodium channel subunit gamma
    • Amiloride-sensitive sodium channel subunit gamma
    • BESC3
    • ENaC gamma subunit
    • ENaCG
    • ENaCgamma
    • Epithelial Na(+) channel subunit gamma
    • Epithelial Na+ channel subunit gamma
    • Gamma ENaC
    • Gamma NaCH
    • Gamma-ENaC
    • Gamma-NaCH
    • Nonvoltage gated sodium channel 1 subunit gamma
    • Nonvoltage-gated sodium channel 1 subunit gamma
    • PHA 1
    • PHA1
    • SCNEG
    • SCNN 1G
    • SCNN1G
    • SCNNG_HUMAN
    • Sodium channel epithelial 1 gamma subunit
    • Sodium channel non voltage gated 1 gamma subunit
    • Sodium channel nonvoltage gated 1 gamma
    see all
  • Function
    Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
  • Involvement in disease
    Defects in SCNN1G are a cause of Liddle syndrome (LIDDS) [MIM:177200]. It is an autosomal dominant disorder characterized by pseudoaldosteronism and hypertension associated with hypokalemic alkalosis. The disease is caused by constitutive activation of the renal epithelial sodium channel.
    Defects in SCNN1G are the cause of bronchiectasis with or without elevated sweat chloride type 3 (BESC3) [MIM:613071]. A debilitating respiratory disease characterized by chronic, abnormal dilatation of the bronchi and other cystic fibrosis-like symptoms in the absence of known causes of bronchiectasis (cystic fibrosis, autoimmune diseases, ciliary dyskinesia, common variable immunodeficiency, foreign body obstruction). Clinical features include sub-normal lung function, sinopulmonary infections, chronic productive cough, excessive sputum production, and elevated sweat chloride in some cases.
  • Sequence similarities
    Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1G subfamily.
  • Post-translational
    modifications
    Phosphorylated on serine and threonine residues.
    Ubiquitinated; this targets individual subunits for endocytosis and proteasome-mediated degradation.
  • Cellular localization
    Apical cell membrane. Apical membrane of epithelial cells.
  • Information by UniProt

Images

  • ab159483 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up