Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTTSALRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNT VAFTEVMGMLWRRLNDSGKNWRHVYKALTLLDYLLKTGSERVAHQCRENL YTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHALKT KERMALEGIGIGSGQLGFSRRYGEDYSRSRGSPSSYNCPASDVRGRGTAA AAGPRHEP
    • Amino acids
      1 to 208
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPN 3
    • EPS 15 interacting protein 3
    • Epsin 3
    • Epsin3
    • FLJ20778
    • MGC129899
    see all
  • Relevance
    EPN3 belongs to the epsin family. It is detected in migrating keratinocytes from wounded skin, but not in differentiating keratinocytes or in normal skin. It is detected in chronic wounds, basal cell carcinoma and ulcerative colitis.
  • Cellular localization
    Cytoplasm. Cytoplasm; perinuclear region. Cytoplasmic vesicle; clathrin-coated vesicle. Nucleus. Note: Concentrated in the perinuclear region and associated with clathrin-coated vesicles close to the cell periphery. May shuttle to the nucleus.

Images

  • ab162943 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up