Recombinant human EPO protein (ab155618)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA WKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVS GLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLR GKLKLYTGEACRTGDR
    • Molecular weight
      18 kDa
    • Amino acids
      28 to 193

Specifications

Our Abpromise guarantee covers the use of ab155618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    The bio-activity was determined by dose-dependent stimulation of the proliferation of TF-1 cells. The ED50<0.2ng/ml, corresponding to a specific activity of not less than 1.5X105 IU/mg.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute ab155618 in sterile PBS to a final concentration of 100 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. Avoid vigorous shaking or vortexing.

General Info

  • Alternative names
    • EP
    • EPO
    • EPO alpha
    • Epoetin
    • Erythropoetin
    • Erythropoietin precursor
    • MVCD2
    see all
  • Relevance
    Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
  • Cellular localization
    Secreted

Images

  • Purity of ab155618 determined by SDS-PAGE analysis under reduced conditions, and stained overnight with Coomassie Blue.

References

ab155618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As


The quality control criteria for bioactivity of EPO is actually no less than 1.5x10e5 IU/mg.
So If customer need 31,500 IU totally, around 210ug is required. Our recommendation is to order 5 vials x50ug to have some safety margin for this case...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up