Recombinant Human Epoxide hydrolase protein (ab114694)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRP FKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNE FDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGW PGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFN SVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNM ALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYM HIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSA FPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLS VLERQ
    • Molecular weight
      76 kDa including tags
    • Amino acids
      1 to 455
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPHX
    • EPHX 1
    • Ephx1
    • EPOX
    • Epoxide hydratase
    • Epoxide hydrolase 1
    • Epoxide hydrolase 1 microsomal (xenobiotic)
    • Epoxide hydroxylase 1
    • Epoxide hydroxylase 1 microsomal (xenobiotic)
    • HYEP_HUMAN
    • HYL1
    • MEH
    • Microsomal epoxide hydrolase
    see all
  • Function
    Biotransformation enzyme that catalyzes the hydrolysis of arene and aliphatic epoxides to less reactive and more water soluble dihydrodiols by the trans addition of water.
  • Tissue specificity
    Found in liver.
  • Involvement in disease
    Note=In some populations, the high activity haplotype tyr113/his139 is overrepresented among women suffering from pregnancy-induced hypertension (pre-eclampsia) when compared with healthy controls.
    Defects in EPHX1 are a cause of familial hypercholanemia (FHCA) [MIM:607748]. FHCA is a disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
  • Sequence similarities
    Belongs to the peptidase S33 family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114694 at approximately 76.12 kDa stained with Coomassie Blue.

References

ab114694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up