Recombinant Human Epoxide hydrolase protein (ab114694)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRP FKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNE FDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGW PGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFN SVATARIFYKLMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNM ALVLSNFSTLTLLLGQRFGRFLGLTERDVELLYPVKEKVFYSLMRESGYM HIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSA FPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLS VLERQ
    • Molecular weight
      76 kDa including tags
    • Amino acids
      1 to 455
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPHX
    • EPHX 1
    • Ephx1
    • EPOX
    • Epoxide hydratase
    • Epoxide hydrolase 1
    • Epoxide hydrolase 1 microsomal (xenobiotic)
    • Epoxide hydroxylase 1
    • Epoxide hydroxylase 1 microsomal (xenobiotic)
    • HYEP_HUMAN
    • HYL1
    • MEH
    • Microsomal epoxide hydrolase
    see all
  • Function
    Biotransformation enzyme that catalyzes the hydrolysis of arene and aliphatic epoxides to less reactive and more water soluble dihydrodiols by the trans addition of water.
  • Tissue specificity
    Found in liver.
  • Involvement in disease
    Note=In some populations, the high activity haplotype tyr113/his139 is overrepresented among women suffering from pregnancy-induced hypertension (pre-eclampsia) when compared with healthy controls.
    Defects in EPHX1 are a cause of familial hypercholanemia (FHCA) [MIM:607748]. FHCA is a disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
  • Sequence similarities
    Belongs to the peptidase S33 family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human Epoxide hydrolase protein images

  • 12.5% SDS-PAGE showing ab114694 at approximately 76.12 kDa stained with Coomassie Blue.

References for Recombinant Human Epoxide hydrolase protein (ab114694)

ab114694 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up