Recombinant Human EPS8L1 protein (ab162865)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRKAIVLAIANTSLAFPLCQHLVTFCLGEDDGVHTVEDASRKLAVMDSQ GRVWAQEMLLRVSPDHVTLLDPASKEELESYPLGAIVRCDAVMPPGRSRS LLLLVCQEPERAQPDVHFFQGLRLGAELIREDIQGALHNYRSGRGERRAA ALRATQEELQRDRSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIP EAEEAQRPEPVGTSSNADSASPDLGPRGPDLAVLQAEREVDILNHVFDDV ESFVSRLQKSAEAARVLEHRERGRRSRRRAAGEGLLTLRAKPPSEAEYTD VLQKIKYAFSLLARLRGNIADPSSPELLHFLFGPLQMIVNTSGGPEFASS VRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRP EFFSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQVTQATQQGRGWEVRGR GRSAWPRLTRLSYFLQQSAPQVAVNGHRDLEPESEPQLESETAGKWVLCN YDFQARNSSELSVKQRDVLEVLEDKEKVSELEAVMEKQKKKVEGEVEMEV I
    • Amino acids
      1 to 551
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DRC3
    • Epidermal growth factor receptor kinase substrate 8 like protein 1
    • Epidermal growth factor receptor kinase substrate 8-like protein 1
    • Epidermal growth factor receptor pathway substrate 8 related protein 1
    • Epidermal growth factor receptor pathway substrate 8-related protein 1
    • EPS8 like 1
    • EPS8 like protein 1
    • EPS8-like protein 1
    • EPS8-related protein 1
    • EPS8L 1
    • Eps8l1
    • EPS8R1
    • ES8L1
    • ES8L1_HUMAN
    • FLJ20258
    • MGC23164
    • MGC4642
    • PP10566
    see all
  • Function
    Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton.
  • Tissue specificity
    Detected in placenta.
  • Sequence similarities
    Belongs to the EPS8 family.
    Contains 1 SH3 domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab162865 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162865.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up