Overview

  • Product name
    Recombinant Human EPX protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MHLLPALAGVLATLVLAQPCEGTDPASPGAVETSVLRDCIAEAKLLVDAA YNWTQKSIKQRLRSGSASPMDLLSYFKQPVAATRTVVRAADYMHVALGLL EEKLQPQRSGPFNVTDVLTEPQLRLLSQASGCALRDQAERCSDKYRTITG RCNNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFLLPLVR AVSNQIVRFPNERLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFTAG VDCERTCAQLPPCFPIKIPPNDPRIKNQRDCIPFFRSAPSCPQNKNRVRN QINALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLP FDNLHDDPCLLTNRSARIPCFLAGDTRSTETPKLAAMHTLFMREHNRLAT ELRRLNPRWNGDKLYNEARKIMGAMVQIITYRDFLPLVLGKARARRTLGH YRGYCSNVDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLS SAFFASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDELRDRLFRQVRR IGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLAR KFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRF WWQKRGVFTKRQRKALSRISLSRIICDNTGITTVSRDIFRANIYPRGFVN CSRIPRLNLSAWRGT
    • Molecular weight
      106 kDa including tags
    • Amino acids
      1 to 715

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Eosinophil peroxidase
    • Eosinophil peroxidase [Precursor]
    • Eosinophil peroxidase heavy chain
    • EPER
    • EPO
    • EPP
    • EPX
    • EPX PEN
    • PERE
    • PERE_HUMAN
    see all
  • Function
    Mediates tyrosine nitration of secondary granule proteins in mature resting eosinophils. Shows significant inhibitory activity towards Mycobacterium tuberculosis H37Rv by inducing bacterial fragmentation and lysis.
  • Involvement in disease
    Defects in EPX are the cause of eosinophil peroxidase deficiency (EPD) [MIM:261500]. EPD is an autosomal recessive defect where anomalous eosinophils are characterized by nuclear hypersegmentation, hypogranulation, and negative peroxidase and phospholipid staining.
  • Sequence similarities
    Belongs to the peroxidase family. XPO subfamily.
  • Cellular localization
    Cytoplasmic granule. Cytoplasmic granules of eosinophils.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152846 stained with Coomassie Blue.

References

ab152846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up