Overview

  • Product nameRecombinant Human ER81 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP50549
    • SpeciesHuman
    • SequenceLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSF PPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAAS QSFPPPLMIK
    • Molecular weight38 kDa including tags
    • Amino acids148 to 257
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • DKFZp781L0674
    • ER81
    • ER81 protein
    • ER81, mouse, homolog of
    • ETS translocation variant 1
    • ets variant gene 1
    • Ets-related protein 81
    • Etsrp81
    • ETV 1
    • ETV1
    • ETV1_HUMAN
    • MGC104699
    • MGC120533
    • MGC120534
    see all
  • FunctionTranscriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'.
  • Tissue specificityVery highly expressed in brain, highly expressed in testis, lung and heart, moderately in spleen, small intestine, pancreas and colon, weakly in liver, prostate and thymus, very weakly in skeletal muscle, kidney and ovary and not in placenta and peripheral blood leukocytes.
  • Involvement in diseaseDefects in ETV1 are a cause of Ewing sarcoma (ES) [MIM:612219]. A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. Note=A chromosomal aberration involving ETV1 is found in patients with Erwing sarcoma. Translocation t(7;22)(p22;q12) with EWSR1.
  • Sequence similaritiesBelongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Post-translational
    modifications
    Sumoylated.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human ER81 protein images

  • ab112285 analysis using 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human ER81 protein (ab112285)

ab112285 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"