Overview

  • Product name
    Recombinant Human ERAS protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGAS GVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQA IHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVG NKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQ RVQEAMAKEPMARSCREKTRHQKATCHCGCSVA
    • Amino acids
      1 to 233
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E ras
    • E-Ras
    • ecat5
    • Embryonic stem cell expressed Ras
    • Embryonic stem cell-expressed Ras
    • Eras
    • ES cell expressed Ras
    • GTPase ERas
    • Ha-Ras2
    • HRAS2
    • HRASP
    • MGC126691
    • MGC126693
    • OTTHUMP00000065857
    • RASE_HUMAN
    • Small GTPase protein E Ras
    • v Ha ras Harvey rat sarcoma viral oncogene homolog pseudogene
    • v Ha ras Harvey rat sarcoma viral oncogene homolog 2
    see all
  • Function
    Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Ras family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158695 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158695 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up