Recombinant human ErbB 3 protein (ab155696)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTG HNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFV MLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRD RDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCF GPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLT FQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKM CEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLN GDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIG GRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLN WTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLS CRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSG SDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQ GCKGPELQDCLGQTLVLIGKTHLT
    • Molecular weight
      72 kDa including tags
    • Amino acids
      60 to 643
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to inhibit the biological activity of Neuregulin1-ß1 on MCF7 Human breast cancer cells. In the presence of 10 ng/ml Recombinant Human NRG1-ß1/HRG1-ß1 Extracellular Domain. The ED50 for this effect is typically 0.5-3.0 µg/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • c erbB 3
    • c erbB3
    • Erb b2 receptor tyrosine kinase 3
    • ErbB 3
    • ERBB3
    • ERBB3 protein
    • erbB3 S
    • ERBB3_HUMAN
    • Glial growth factor receptor
    • HER 3
    • HER3
    • Human epidermal growth factor receptor 3
    • LCCS2
    • MDA BF 1
    • MGC88033
    • p180 ErbB3
    • p45 sErbB3
    • p85 sErbB3
    • proto-oncogene-like protein c ErbB 3
    • proto-oncogene-like protein c ErbB3
    • Proto-oncogene-like protein c-ErbB-3
    • Receptor tyrosine protein kinase erbB 3
    • Receptor tyrosine protein kinase erbB3
    • Receptor tyrosine-protein kinase erbB-3
    • Tyrosine kinase type cell surface receptor HER3
    • Tyrosine kinase-type cell surface receptor HER3
    • v erb b2 avian erythroblastic leukemia viral oncogene homolog 3
    • v erb b2 erythroblastic leukemia viral oncogene homolog 3
    • v erb b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
    see all
  • Function
    Binds and is activated by neuregulins and NTAK.
  • Tissue specificity
    Epithelial tissues and brain.
  • Involvement in disease
    Defects in ERBB3 are the cause of lethal congenital contracture syndrome type 2 (LCCS2) [MIM:607598]; also called Israeli Bedouin multiple contracture syndrome type A. LCCS2 is an autosomal recessive neurogenic form of a neonatally lethal arthrogryposis that is associated with atrophy of the anterior horn of the spinal cord. The LCCS2 syndrome is characterized by multiple joint contractures, anterior horn atrophy in the spinal cord, and a unique feature of a markedly distended urinary bladder. The phenotype suggests a spinal cord neuropathic etiology.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.
    Contains 1 protein kinase domain.
  • Developmental stage
    Overexpressed in a subset of human mammary tumors.
  • Domain
    The cytoplasmic part of the receptor may interact with the SH2 or SH3 domains of many signal-transducing proteins.
  • Post-translational
    modifications
    Ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE of reduced ab155696 stained overnight with Coomassie Blue.

References

ab155696 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155696.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up