Recombinant Human ERCC6L2 protein (ab166383)

Overview

  • Product name
    Recombinant Human ERCC6L2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQKERELQETIYFKNTWPACMFLIVAPLSVLYNWKDELDTWGYFRVTVLH GNRKDNELIRVKQRKCEIALTTYETLRLCLDELNSLEWSAVIVDEAHRIK NPKARVTEVMKALKCNVRIGLTGTILQNNMKELWCVMDWAVPGLLGSGTY FKKQFSDPVEHGQRHTATKRELATGRKAMQRLAKKMSGWFLRRTKTLIKD QLPKKEDRMVYCSLTDFQKAVYQTVLETEDVTLILQSSEPCTCRSGQKRR NCCYKTNSHGETVKTLYLSYLTVLQKVANHVALLQAASTSKQQETLIKRI CDQVFSRFPDFVQKSKDAAFETLSDPKYSGKMKVLQQLLNHCRKNRDKVL LFSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNSTQDVNI CLVSTMAGGLGLNFVGANVVVLFDPTWNPANDLQAIDRAYRIGQCRDVKV LRLISLGTVEEIMYLRQIYKQQLHCVVVGSENAKRYFEAVQGSKEHQGEL FGIHNLFKFRSQGSCLTKDILEV
    • Amino acids
      1 to 523
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C9orf102
    • Chromosome 9 open reading frame 102
    • excision repair cross-complementing rodent repair deficiency, complementation group 6-like 2
    • FLJ37706
    • MGC30192
    • MGC43364
    • Putative DNA repair and recombination protein RAD26-like
    • putative repair and recombination helicase RAD26L
    • RAD26_HUMAN
    • Rad26l
    • RAD26L hypothetical protein
    • SR278
    • stretch responsive protein 278
    see all
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab166383 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up