Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13216
    • SpeciesHuman
    • SequenceMLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVERIHGGGINTLD IEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKAVCSIGRDHPDVHRY SVETVQWYPHDTGMFTSSSFDKTLKVWDTNTLQTADVFNFEETVYSHHMS PVSTKHCLVAVGTRGPKVQLCDLKSGSCSHILQGHRQEILAVSWSPRYDY ILATASADSRVKLWDVRRASGCLITLDQHNGKKSQAVESANTAHNGKVNG LCFTSDGLHLLTVGTDNRMRLWNSSNGENTLVNYGKVCNNSKKGLKFTVS CGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELY SGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
    • Molecular weight70 kDa including tags
    • Amino acids1 to 396

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CKN1
    • Cockayne syndrome type A
    • Cockayne syndrome WD repeat protein CSA
    • CSA
    • DNA excision repair protein ERCC-8
    • DNA excision repair protein ERCC8
    • ERCC 8
    • ERCC8
    • ERCC8_HUMAN
    • excision repair cross-complementing rodent repair deficiency, complementation group 8
    see all
  • FunctionSubstrate-recognition component of the CSA complex, a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex, involved in transcription-coupled nucleotide excision repair. The CSA complex (DCX(ERCC8) complex) promotes the ubiquitination and subsequent proteasomal degradation of ERCC6 in a UV-dependent manner; ERCC6 degradation is essential for the recovery of RNA synthesis after transcription-coupled repair. It is required for the recruitement of XAB2, HMGN1 and TCEA1/TFIIS to a transcription-coupled repair complex which removes RNA polymerase II-blocking lesions from the transcribed strand of active genes.
  • PathwayProtein modification; protein ubiquitination.
  • Involvement in diseaseDefects in ERCC8 are the cause of Cockayne syndrome type A (CSA) [MIM:216400]. Cockayne syndrome is a rare disorder characterized by cutaneous sensitivity to sunlight, abnormal and slow growth, cachectic dwarfism, progeroid appearance, progressive pigmentary retinopathy and sensorineural deafness. There is delayed neural development and severe progressive neurologic degeneration resulting in mental retardation. Two clinical forms are recognized: in the classical form or Cockayne syndrome type 1, the symptoms are progressive and typically become apparent within the first few years or life; the less common Cockayne syndrome type 2 is characterized by more severe symptoms that manifest prenatally. Cockayne syndrome shows some overlap with certain forms of xeroderma pigmentosum. Unlike xeroderma pigmentosum, patients with Cockayne syndrome do not manifest increased freckling and other pigmentation abnormalities in the skin and have no significant increase in skin cancer.
  • Sequence similaritiesContains 5 WD repeats.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human ERCC8 protein images

  • ab114805 on 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human ERCC8 protein (ab114805)

ab114805 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"