Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP62495
    • SpeciesHuman
    • SequenceTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGA TLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
    • Molecular weight37 kDa including tags
    • Amino acids338 to 437

Specifications

Our Abpromise guarantee covers the use of ab116909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cl1 protein
    • D5S1995
    • ERF
    • eRF1
    • ERF1_HUMAN
    • ETF1
    • Eukaryotic peptide chain release factor subunit 1
    • Eukaryotic release factor 1
    • Eukaryotic translation termination factor 1
    • MGC111066
    • Polypeptide chain release factor 1
    • Protein Cl1
    • RF1
    • Sup45 (yeast omnipotent suppressor 45) homolog like 1
    • SUP45L1
    • TB3 1
    • TB3-1
    see all
  • FunctionDirects the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
  • Sequence similaritiesBelongs to the eukaryotic release factor 1 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human eRF1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116909 at approximately 36.63 kDa.

References for Recombinant Human eRF1 protein (ab116909)

ab116909 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"