Recombinant Human eRF3B/GSPT2 protein (ab161753)

Overview

  • Product name
    Recombinant Human eRF3B/GSPT2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDSGSSSSDSAPDCWDQVDMESTGSAPSGDGVSSAVAEAQREPLSSAFSR KLNVNAKPFVPNVHAAEFVPSFLRGPTQPPTLPAGSGSNDETCTGAGYPQ GKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENGEVEMALEESW EHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPK KEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETW YLSWALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIG GASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINK MDDHTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTGANIKE QSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGTVVLGKL ESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGENLKIRLKGIEE EEILPGFILCDPSNLCHSGRTFDVQIVIIEHKSIICPGYNAVLHIHTCIE EVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDF PQMGRFTLRDEGKTIAIGKVLKLVQEKD
    • Amino acids
      1 to 628
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • eRF3b
    • ERF3B_HUMAN
    • Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
    • Eukaryotic peptide chain release factor subunit 3b
    • G1 to S phase transition 2
    • G1 to S phase transition protein 2 homolog
    • Gspt2
    • GST2
    • peptide chain release factor 3
    see all
  • Function
    Involved in translation termination in response to the termination codons UAA, UAG and UGA. May play a role as a potent stimulator of the release factor activity of ETF1. Exhibits GTPase activity, which is ribosome- and ETF1-dependent. May play a role in cell cycle progression. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
  • Tissue specificity
    Highly expressed in IUCC stage II colorectal cancer (CRC).
  • Sequence similarities
    Belongs to the GTP-binding elongation factor family. ERF3 subfamily.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161753 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up