Recombinant Human eRF3/GSPT1 protein (ab152442)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEK SKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIG KVLKLVPEKD
    • Molecular weight
      38 kDa including tags
    • Amino acids
      390 to 499

Specifications

Our Abpromise guarantee covers the use of ab152442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 551G9.2
    • Anti Eukaryotic Release Factor 3a
    • Anti G1 to S phase transition 1
    • Anti GST1, homolog of yeast
    • eRF 3a
    • eRF3a
    • G1 to S phase transition 1
    • G1 to S phase transition protein
    • G1 to S phase transition protein 1 homolog
    • GSPT 1
    • GSPT1
    • GST 1
    • GST1
    • GTP binding protein GST1 HS
    • Transition protein 1
    see all
  • Relevance
    Translation termination in eukaryotes is governed by two proteins, belonging to the class-1 (eRF1) and class-2 (eRF3) polypeptide release factors. eRF3/GSPT1 is involved in regulation of mammalian cell growth and belongs to the GTP-binding elongation factor family (ERF3 subfamily). eRF3 catalyzes hydrolysis of GTP to GDP and inorganic phosphate in the ribosome in the absence of mRNA, tRNA, aminoacyl-tRNA and peptidyl-tRNA.
  • Cellular localization
    Cytoplasmic

Images

  • 12.5% SDS-PAGE analysis of ab152442 stained with Coomassie Blue.

References

ab152442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up