Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP11308
    • SpeciesHuman
    • SequenceMASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPR VPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPD TV
    • Molecular weight37 kDa including tags
    • Amino acids1 to 100
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    Western blot

    SDS-PAGE

    ELISA

    Peptide Array

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Reduced glutathione

General Info

  • Alternative names
    • Avian erythroblastosis virus E-26 (v-ets) oncogene related
    • D030036I24Rik
    • Erg
    • Erg 3
    • ERG/EWS fusion gene, included
    • ERG/FUS fusion gene, included
    • ERG/TMPSSR2 fusion gene, included
    • ERG_HUMAN
    • ERG1, included
    • ERG2, included
    • ets related
    • ETS-related gene
    • KCNH2
    • Oncogene ERG
    • p55
    • TMPRSS2/ERG fusion
    • Transcriptional regulator ERG
    • transcriptional regulator ERG (transforming protein ERG)
    • Transforming protein ERG
    • v ets avian erythroblastosis virus E26 oncogene
    • v ets avian erythroblastosis virus E26 oncogene related
    • v ets erythroblastosis virus E26 oncogene homolog
    • v ets erythroblastosis virus E26 oncogene like
    • v ets erythroblastosis virus E26 oncogene like isoform 2
    • v-ets erythroblastosis virus E26 oncogene
    • v-ets erythroblastosis virus E26 oncogene homolog (avian)
    • V-ets erythroblastosis virus E26 oncogene like (Avian), isoform CRA_e
    see all
  • FunctionTranscriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.
  • Involvement in diseaseDefects in ERG are a cause of Ewing sarcoma (ES) [MIM:612219]. A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. Note=A chromosomal aberration involving ERG is found in patients with Erwing sarcoma. Translocation t(21;22)(q22;q12) with EWSR1.
    Note=Chromosomal aberrations involving ERG have been found in acute myeloid leukemia (AML). Translocation t(16;21)(p11;q22) with FUS. Translocation t(X;21)(q25-26;q22) with ELF4.
  • Sequence similaritiesBelongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Cellular localizationNucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Recombinant Human ERG protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue with recombinant protein.

References for Recombinant Human ERG protein (ab112284)

ab112284 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"