Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPR VPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTV GMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEY GLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPL PHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDL PYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPYQILGPTS SRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARR WGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQ PHPPESSLYKYPSDLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPN PYWNSPTGGIYPNTRLPTSHMPSHLGTYY
    • Amino acids
      1 to 479
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158384 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Avian erythroblastosis virus E-26 (v-ets) oncogene related
    • D030036I24Rik
    • Erg
    • Erg 3
    • ERG/EWS fusion gene, included
    • ERG/FUS fusion gene, included
    • ERG/TMPSSR2 fusion gene, included
    • ERG_HUMAN
    • ERG1, included
    • ERG2, included
    • ets related
    • ETS-related gene
    • KCNH2
    • Oncogene ERG
    • p55
    • TMPRSS2/ERG fusion
    • Transcriptional regulator ERG
    • transcriptional regulator ERG (transforming protein ERG)
    • Transforming protein ERG
    • v ets avian erythroblastosis virus E26 oncogene
    • v ets avian erythroblastosis virus E26 oncogene related
    • v ets erythroblastosis virus E26 oncogene homolog
    • v ets erythroblastosis virus E26 oncogene like
    • v ets erythroblastosis virus E26 oncogene like isoform 2
    • v-ets erythroblastosis virus E26 oncogene
    • v-ets erythroblastosis virus E26 oncogene homolog (avian)
    • V-ets erythroblastosis virus E26 oncogene like (Avian), isoform CRA_e
    see all
  • Function
    Transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.
  • Involvement in disease
    Defects in ERG are a cause of Ewing sarcoma (ES) [MIM:612219]. A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. Note=A chromosomal aberration involving ERG is found in patients with Erwing sarcoma. Translocation t(21;22)(q22;q12) with EWSR1.
    Note=Chromosomal aberrations involving ERG have been found in acute myeloid leukemia (AML). Translocation t(16;21)(p11;q22) with FUS. Translocation t(X;21)(q25-26;q22) with ELF4.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Cellular localization
    Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Images

  • ab158384 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158384 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158384.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up