Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSHTILLVQPTKRPEGRTYADYESVNE CMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQ TYQPYNKDWIKEKIYVLLRRQAQQAGK
    • Molecular weight
      15 kDa including tags
    • Amino acids
      1 to 104
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab104674 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • DROER
    • Enhancer of rudimentary homolog
    • Enhancer of rudimentary homolog (Drosophila)
    • ERH
    • ERH_HUMAN
    • FLJ27340
    • HGNC:3447
    see all
  • Function
    May have a role in the cell cycle.
  • Tissue specificity
    Expressed in all tissues examined.
  • Sequence similarities
    Belongs to the E(R) family.
  • Information by UniProt

Recombinant Human ERH protein images

  • 15% SDS-PAGE analysis of 3µg ab104674.

References for Recombinant Human ERH protein (ab104674)

ab104674 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up