Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAAAAAQGGGGGEPRRTEGV GPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAI KKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPS NLLSNTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSK GYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLN CIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRIT VEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETAR FQPGVLEAP
    • Molecular weight
      70 kDa including tags
    • Amino acids
      2 to 379

Specifications

Our Abpromise guarantee covers the use of ab116536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity: 379.25 units/ml; 621.73 Units/mg
  • Applications

    SDS-PAGE

    Functional Studies

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 80 % Proprietary Purification.

  • Form
    Liquid
  • Additional notes
    ab116536 was alkylated, digested with trypsin and the mass of the resultant peptides determined by MADLI-TOF/TOF. The peptides obtained gave 27% sequence coverage of ERK1. Theoretical pI: 6.06
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.002% Brij, 0.012% Benzamidine, 0.003% EGTA, 0.003% PMSF, 0.1% Beta mercaptoethanol, 0.79% Tris HCl, 9.24% Sucrose, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • ERK
    • ERK 1
    • ERK-1
    • ERK1
    • ERT 2
    • ERT2
    • Extracellular Signal Regulated Kinase 1
    • Extracellular signal related kinase 1
    • Extracellular signal-regulated kinase 1
    • HGNC6877
    • HS44KDAP
    • HUMKER1A
    • Insulin Stimulated MAP2 Kinase
    • Insulin-stimulated MAP2 kinase
    • MAP Kinase
    • MAP kinase 1
    • MAP kinase 3
    • MAP kinase isoform p44
    • MAPK
    • MAPK 1
    • MAPK 3
    • MAPK1
    • Mapk3
    • MGC20180
    • Microtubule Associated Protein 2 Kinase
    • Microtubule-associated protein 2 kinase
    • Mitogen Activated Protein Kinase 3
    • Mitogen-activated protein kinase 1
    • Mitogen-activated protein kinase 3
    • MK03_HUMAN
    • OTTHUMP00000174538
    • OTTHUMP00000174541
    • p44 ERK1
    • p44 MAPK
    • p44-ERK1
    • p44-MAPK
    • P44ERK1
    • P44MAPK
    • PRKM 3
    • PRKM3
    • Protein Kinase Mitogen Activated 3
    see all
  • Function
    Involved in both the initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors such as ELK-1. Phosphorylates EIF4EBP1; required for initiation of translation. Phosphorylates microtubule-associated protein 2 (MAP2). Phosphorylates SPZ1 (By similarity). Phosphorylates heat shock factor protein 4 (HSF4).
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications
    Dually phosphorylated on Thr-202 and Tyr-204, which activates the enzyme. Dephosphorylated by PTPRJ at Tyr-204.
  • Information by UniProt

Images

  • 12% SDS-PAGE gel showing ab116536.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up