Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP27361
    • SpeciesHuman
    • SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAAAAAQGGGGGEPRRTEGV GPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAI KKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPS NLLSNTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSK GYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLN CIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRIT VEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETAR FQPGVLEAP
    • Molecular weight70 kDa including tags
    • Amino acids2 to 379

Specifications

Our Abpromise guarantee covers the use of ab116536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity: 379.25 units/ml; 621.73 Units/mg
  • Applications

    SDS-PAGE

    Functional Studies

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity> 80 % Proprietary Purification.

  • FormLiquid
  • Additional notesab116536 was alkylated, digested with trypsin and the mass of the resultant peptides determined by MADLI-TOF/TOF. The peptides obtained gave 27% sequence coverage of ERK1. Theoretical pI: 6.06
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.002% Brij, 0.012% Benzamidine, 0.003% EGTA, 0.003% PMSF, 0.1% Beta mercaptoethanol, 0.79% Tris HCl, 9.24% Sucrose, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • ERK
    • ERK 1
    • ERK-1
    • ERK1
    • ERT 2
    • ERT2
    • Extracellular Signal Regulated Kinase 1
    • Extracellular signal related kinase 1
    • Extracellular signal-regulated kinase 1
    • HGNC6877
    • HS44KDAP
    • HUMKER1A
    • Insulin Stimulated MAP2 Kinase
    • Insulin-stimulated MAP2 kinase
    • MAP Kinase
    • MAP kinase 1
    • MAP kinase 3
    • MAP kinase isoform p44
    • MAPK
    • MAPK 1
    • MAPK 3
    • MAPK1
    • Mapk3
    • MGC20180
    • Microtubule Associated Protein 2 Kinase
    • Microtubule-associated protein 2 kinase
    • Mitogen Activated Protein Kinase 3
    • Mitogen-activated protein kinase 1
    • Mitogen-activated protein kinase 3
    • MK03_HUMAN
    • OTTHUMP00000174538
    • OTTHUMP00000174541
    • p44 ERK1
    • p44 MAPK
    • p44-ERK1
    • p44-MAPK
    • P44ERK1
    • P44MAPK
    • PRKM 3
    • PRKM3
    • Protein Kinase Mitogen Activated 3
    see all
  • FunctionInvolved in both the initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors such as ELK-1. Phosphorylates EIF4EBP1; required for initiation of translation. Phosphorylates microtubule-associated protein 2 (MAP2). Phosphorylates SPZ1 (By similarity). Phosphorylates heat shock factor protein 4 (HSF4).
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • DomainThe TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications
    Dually phosphorylated on Thr-202 and Tyr-204, which activates the enzyme. Dephosphorylated by PTPRJ at Tyr-204.
  • Information by UniProt

Recombinant human ERK1 protein images

  • 12% SDS-PAGE gel showing ab116536.

References for Recombinant human ERK1 protein (ab116536)

This product has been referenced in:

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab116536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"