Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13164-2
    • SpeciesHuman
    • SequencePQSSMSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEE FLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREI QMDSPMLLADLPDLQDP
    • Molecular weight39 kDa including tags
    • Amino acids561 to 677

Specifications

Our Abpromise guarantee covers the use of ab114671 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Big MAP kinase 1
    • BMK 1
    • BMK 1 kinase
    • BMK-1
    • BMK1
    • BMK1 Kinase
    • EC 2.7.11.24
    • ERK 4
    • ERK 5
    • ERK-5
    • ERK4
    • ERK5
    • Extracellular signal regulated kinase 5
    • Extracellular signal-regulated kinase 5
    • MAP kinase 7
    • MAPK 7
    • MAPK7
    • Mitogen activated protein kinase 7
    • Mitogen-activated protein kinase 7
    • MK07_HUMAN
    • OTTHUMP00000065906
    • OTTHUMP00000065907
    • PRKM 7
    • PRKM7
    • PROTEIN KINASE, MITOGEN-ACTIVATED, 7
    see all
  • FunctionPlays a role in various cellular processes such as proliferation, differentiation and cell survival. The upstream activator of MAPK7 is the MAPK kinase MAP2K5. Upon activation, it translocates to the nucleus and phosphorylates various downstream targets including MEF2C. EGF activates MAPK7 through a Ras-independent and MAP2K5-dependent pathway. May have a role in muscle cell differentiation. May be important for endothelial function and maintenance of blood vessel integrity. MAP2K5 and MAPK7 interact specifically with one another and not with MEK1/ERK1 or MEK2/ERK2 pathways.
  • Tissue specificityExpressed in many adult tissues. Abundant in heart, placenta, lung, kidney and skeletal muscle. Not detectable in liver.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • DomainThe second proline-rich region may interact with actin targeting the kinase to a specific location in the cell.
    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications
    Dually phosphorylated on Thr-219 and Tyr-221, which activates the enzyme (By similarity). Autophosphorylated in vitro on threonine and tyrosine residues when the C-terminal part of the kinase, which could have a regulatory role, is absent.
  • Cellular localizationCytoplasm. Nucleus. Translocates to the nucleus upon activation.
  • Information by UniProt

Recombinant Human ERK5 protein images

  • SDS-PAGE analysis of ab114671 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human ERK5 protein (ab114671)

ab114671 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114671.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"