Recombinant Human ERM / Etv5 protein (ab114594)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFP PQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPG PPAHGFQSPM
    • Molecular weight
      38 kDa including tags
    • Amino acids
      181 to 290

Specifications

Our Abpromise guarantee covers the use of ab114594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ERM
    • Ets related protein ERM
    • ETS translocation variant 5
    • Ets variant gene 5
    • Ets-related protein ERM
    • ETV5
    • ETV5_HUMAN
    see all
  • Function
    Binds to DNA sequences containing the consensus nucleotide core sequence GGAA.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human ERM / Etv5 protein images

  • 12.5% SDS-PAGE showing ab114594 at approximately 37.73kDa stained with Coomassie Blue.

References for Recombinant Human ERM / Etv5 protein (ab114594)

ab114594 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up