Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEA AASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEP KDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQG MKEAQERLTGDAFRKKHLEDEL
    • Molecular weight
      19 kDa
    • Amino acids
      1 to 172

Specifications

Our Abpromise guarantee covers the use of ab153794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Supplied as a 0.2 µM filtered solution.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 89% Phosphate Buffer, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • AG1
    • AGR1
    • anterior gradient homolog 1
    • endoplasmic reticulum protein ERp19
    • endoplasmic reticulum resident protein 18
    • endoplasmic reticulum resident protein 19
    • endoplasmic reticulum thioredoxin superfamily member, 18 kDa
    • ER protein 18
    • ER protein 19
    • ERP 18
    • ERP16
    • ERP19
    • hAG 1
    • hAG1
    • hTLP19
    • PDIA16
    • protein disulfide isomerase family A, member 16
    • thioredoxin domain containing 12 (endoplasmic reticulum
    • Thioredoxin domain-containing protein 12
    • thioredoxin like protein p19
    • TLP19
    • TXNDC12
    see all
  • Relevance
    ERp19 belongs to the thioredoxin superfamily. Members of this superfamily possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors. Possesses significant protein thiol-disulfide oxidase activity.
  • Cellular localization
    Endoplasmic reticulum

References

ab153794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up