Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRL KGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGI VSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKA ASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTE QKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAK GSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIP VVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESN DGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLS KDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELS DFISYLQREATNPPVIQEEKPKKKKKAQEDLVDHHHHHH
    • Molecular weight
      55 kDa including tags
    • Amino acids
      25 to 505
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein from aa 25 to 505. The signal peptide is not included

Specifications

Our Abpromise guarantee covers the use of ab191803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 10% Glycerol, 0.32% Tris HCl, 0.87% Sodium chloride

General Info

  • Alternative names
    • 58 kDa glucose regulated protein
    • 58 kDa glucose-regulated protein
    • 58 kDa microsomal protein
    • Disulfide isomerase ER 60
    • Disulfide isomerase ER-60
    • Endoplasmic reticulum resident protein 57
    • Endoplasmic reticulum resident protein 60
    • ER p57
    • ER protein 57
    • ER protein 60
    • ERp 57
    • ERp57
    • ERp60
    • ERp61
    • Glucose Regulated Protein 58 Kd
    • GRP 57
    • GRP 58
    • GRP57
    • HsT17083
    • p58
    • PDIA 3
    • PDIA3
    • PDIA3_HUMAN
    • Phospholipase C alpha
    • PI PLC
    • Protein disulfide isomerase A3
    • Protein disulfide isomerase family A member 3
    • Protein disulfide-isomerase A3
    see all
  • Tissue specificity
    Detected in the flagellum and head region of spermatozoa (at protein level).
  • Sequence similarities
    Belongs to the protein disulfide isomerase family.
    Contains 2 thioredoxin domains.
  • Cellular localization
    Endoplasmic reticulum lumen. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

References

ab191803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up