Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP13667
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMVAGAEGPDEDSSNRENAIEDEEEEEEEDD DEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAP EYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAV DYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILV EFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDV SGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEF LKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLK VSQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGH RKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYT FAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLR EFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIE FYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEG FPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
    • Molecular weight73 kDa
    • Amino acids21 to 645
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99295 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99295 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Calcium binding protein intestinal related
    • Endoplasmic reticulum resident protein 70
    • Endoplasmic reticulum resident protein 72
    • EPR70
    • EPR72
    • ER protein 70
    • ER protein 72
    • ERP 70
    • ERp 72
    • ERp-72
    • ERp70
    • ERp72
    • PDIA 4
    • Pdia4
    • PDIA4_HUMAN
    • PDIR
    • Protein disulfide isomerase A4
    • Protein disulfide isomerase associated 4
    • Protein disulfide isomerase family A member 4
    • Protein disulfide isomerase related protein
    • protein disulfide isomerase related protein (calcium-binding protein, intestinal-related)
    • Protein disulfide-isomerase A4
    • Protein ERp 72
    • Protein ERp72
    see all
  • Sequence similaritiesBelongs to the protein disulfide isomerase family.
    Contains 3 thioredoxin domains.
  • Cellular localizationEndoplasmic reticulum lumen. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant Human ERp72 protein images

  • 15% SDS-PAGE showing ab99295 (3µg).

References for Recombinant Human ERp72 protein (ab99295)

ab99295 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99295.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"