Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96AP7
    • SpeciesHuman
    • SequenceISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLP AWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLV YSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLV PPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPA LDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGARSHH HHHH
    • Molecular weight28 kDa including tags
    • Amino acids2 to 247
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    Purity is >95%, by SDS-PAGE and silver stain.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Constituent: PBS

  • ReconstitutionThe lyophilized ESAM should be reconstituted in water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions.

General Info

  • Alternative names
    • 2310008D05Rik
    • Endothelial cell adhesion molecule
    • Endothelial cell selective adhesion molecule
    • Endothelial cell-selective adhesion molecule
    • Esam
    • ESAM_HUMAN
    • HUEL (C4orf1) interacting protein
    • LP4791 protein
    • W117m
    see all
  • FunctionCan mediate aggregation most likely through a homophilic molecular interaction.
  • Tissue specificityHighly expressed in endothelial cells.
  • Sequence similaritiesContains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localizationCell junction > adherens junction. Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Recombinant Human ESAM protein images

  • SDS-PAGE of recombinant human ESAM (ab113199). The sample was loaded in 15% SDS- polyacrylamide gel under reducing conditions and stained with Coomassie blue.

References for Recombinant Human ESAM protein (ab113199)

ab113199 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"