Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLP AWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLV YSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLV PPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPA LDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGARSHH HHHH
    • Molecular weight
      28 kDa including tags
    • Amino acids
      2 to 247
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    Purity is >95%, by SDS-PAGE and silver stain.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Constituent: PBS

  • Reconstitution
    The lyophilized ESAM should be reconstituted in water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions.

General Info

  • Alternative names
    • 2310008D05Rik
    • Endothelial cell adhesion molecule
    • Endothelial cell selective adhesion molecule
    • Endothelial cell-selective adhesion molecule
    • Esam
    • ESAM_HUMAN
    • HUEL (C4orf1) interacting protein
    • LP4791 protein
    • W117m
    see all
  • Function
    Can mediate aggregation most likely through a homophilic molecular interaction.
  • Tissue specificity
    Highly expressed in endothelial cells.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Cell junction > adherens junction. Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE of recombinant human ESAM (ab113199). The sample was loaded in 15% SDS- polyacrylamide gel under reducing conditions and stained with Coomassie blue.

References

ab113199 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up