Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP78545
    • SpeciesHuman
    • SequenceEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAV AQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGW KEEEVLQSRN
    • Molecular weight38 kDa including tags
    • Amino acids262 to 371

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E74 like factor 3
    • E74 like factor 3 ets domain transcription factor
    • E74 like factor 3 ets domain transcription factor epithelial specific
    • E74 like factor 3 ETS domain transcription factor serine box epithelial specific
    • E74-like factor 3
    • Elf3
    • ELF3_HUMAN
    • Epithelial restricted with serine box
    • Epithelial-restricted with serine box
    • Epithelium restricted Ets protein ESX
    • Epithelium specific Ets factor 1
    • Epithelium specific Ets transcription factor 1
    • Epithelium-restricted Ets protein ESX
    • Epithelium-specific Ets transcription factor 1
    • EPR 1
    • EPR1
    • ERT
    • ESE-1
    • ESX
    • Ets domain transcription factor serine box
    • Ets domain transcription factor serine box epithelial specific
    • Ets transcription factor
    • ETS-related transcription factor Elf-3
    • jen
    • MGC139318
    see all
  • FunctionTranscriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
  • Tissue specificityExpressed exclusively in tissues containing a high content of terminally differentiated epithelial cells including mammary gland, colon, trachea, kidney, prostate, uterus, stomach and skin.
  • Sequence similaritiesBelongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Domainthe 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Cellular localizationCytoplasm. Nucleus. Localizes to the cytoplasm where it has been shown to transform MCF-12A mammary epithelial cells via a novel cytoplasmic mechanism. Also transiently expressed and localized to the nucleus where it induces apoptosis in non-transformed breast epithelial cells MCF-10A and MCF-12A via a transcription-dependent mechanism.
  • Information by UniProt

Recombinant Human ESE1 protein images

  • 12.5% SDS-PAGE showing ab114718 at approximately 37.73kDa stained with Coomassie Blue.

References for Recombinant Human ESE1 protein (ab114718)

ab114718 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"