Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WSNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTV SGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQS GICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKE NAAGSPVMRKWLNPRVDHHHHHH
    • Molecular weight
      19 kDa including tags
    • Amino acids
      20 to 184
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151391 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Lyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • Endocan
    • Endothelial cell specific molecule 1
    • Endothelial cell-specific molecule 1
    • ESM 1
    • ESM 1 secretory protein
    • ESM-1
    • Esm1
    • ESM1 secretory protein
    • ESM1_HUMAN
    see all
  • Function
    May have potent implications in lung endothelial cell-leukocyte interactions.
  • Tissue specificity
    Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney.
  • Sequence similarities
    Contains 1 IGFBP N-terminal domain.
  • Post-translational
    modifications
    May contain intrachain disulfide bonds.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151391 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151391.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up