Recombinant Human Estrogen Inducible Protein pS2 (ab109944)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP04155
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEAQTETCTVAPRERQNCGFPGVTPSQCAN KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
    • Molecular weight9 kDa including tags
    • Amino acids25 to 84
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab109944 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • BCEI
    • Breast cancer estrogen inducible protein
    • Breast cancer estrogen inducible sequence
    • Breast cancer estrogen-inducible protein
    • D21S21
    • Gastrointestinal trefoil protein
    • Gastrointestinal trefoil protein pS2
    • hP1.A
    • HP1A
    • HPS 2
    • HPS2
    • pNR 2
    • PNR-2
    • pNR2
    • Polypeptide P1.A
    • Protein pS2
    • PS 2
    • pS2
    • pS2 protein
    • TFF 1
    • TFF1
    • TFF1_HUMAN
    • Trefoil factor 1
    see all
  • FunctionStabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
  • Tissue specificityFound in stomach, with highest levels in the upper gastric mucosal cells (at protein level). Detected in goblet cells of the small and large intestine and rectum, small submucosal glands in the esophagus, mucous acini of the sublingual gland, submucosal glands of the trachea, and epithelial cells lining the exocrine pancreatic ducts but not in the remainder of the pancreas (at protein level). Scattered expression is detected in the epithelial cells of the gallbladder and submucosal glands of the vagina, and weak expression is observed in the bronchial goblet cells of the pseudostratified epithelia in the respiratory system (at protein level). Detected in urine (at protein level). Strongly expressed in breast cancer but at low levels in normal mammary tissue. It is regulated by estrogen in MCF-7 cells. Strong expression found in normal gastric mucosa and in the regenerative tissues surrounding ulcerous lesions of gastrointestinal tract, but lower expression found in gastric cancer (at protein level).
  • Sequence similaritiesContains 1 P-type (trefoil) domain.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Estrogen Inducible Protein pS2 images

  • 15% SDS-PAGE analysis of 3µg ab109944.

References for Recombinant Human Estrogen Inducible Protein pS2 (ab109944)

ab109944 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"