Recombinant Human Estrogen Related Receptor gamma protein (ab114455)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSST MNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLN SMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECE ITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPY LNPQLVQPAKKPLLWSDPADNKIVSHLLVAEPEKIYAMPDPTAPDSDIKA LTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVV YRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKE EFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRA GKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLLLEMLEAKV
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 442

Specifications

Our Abpromise guarantee covers the use of ab114455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114455 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • DKFZp781L1617
    • ERR 3
    • ERR G2
    • ERR gamma 2
    • ERR gamma-2
    • ERR3
    • ERR3_HUMAN
    • ERRG 2
    • ERRG2
    • ERRgamma
    • ESRRG
    • Estrogen receptor related protein 3
    • Estrogen receptor-related protein 3
    • Estrogen-related receptor gamma
    • FLJ16023
    • KIAA0832
    • NR3B3
    • Nuclear receptor subfamily 3 group B member 3
    see all
  • Function
    Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.
  • Tissue specificity
    Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR3 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Developmental stage
    Expressed at high levels in fetal brain and also in the fetal kidney, lung and liver.
  • Post-translational
    modifications
    Sumoylation on Lys-40 is enhanced by phosphorylation at Ser-45 and represses transcriptional activity.
    Phosphorylation on Ser-45 enhances sumoylation on Lys-40 thus repressing transcriptional activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human Estrogen Related Receptor gamma protein images

  • ab114455 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human Estrogen Related Receptor gamma protein (ab114455)

ab114455 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up