Overview

  • Product name
    Recombinant Human ESX1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AEGPQTAEGPQPPERKRRRRTAFTQFQLQELENFFDESQYPDVVARERLA ARLNLTEDRVQVWFQNRRAKWKRNQRVLMLRNTATADLAH
    • Amino acids
      124 to 213
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Epx
    • ESX1
    • ESX1_HUMAN
    • ESX1L
    • ESXR1
    • Etx
    • Extraembryonic
    • Extraembryonic spermatogenesis homeobox 1
    • homeobox 1
    • Homeobox protein ESX1-C
    • spermatogenesis
    • Spx1
    see all
  • Function
    May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which is present within the first intron of the KRAS gene and inhibits its expression. ESXR1-C has the ability to inhibit cyclin turnover.
  • Tissue specificity
    Expressed in placenta and testis. Expressed in testicular germ cell tumors.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications
    Undergoes proteolytic cleavage; produces a 45 kDa N-terminal homeodomain-containing fragment (ESXR1-N) and a 20 kDa C-terminal fragment (ESXR1-C).
  • Cellular localization
    Cytoplasm. Nucleus. ESXR1-N localizes specifically to the nucleus while ESXR1-C localizes specifically to the cytoplasm.
  • Information by UniProt

Images

  • ab164279 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164279 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up