Recombinant Human ETFB protein (ab107152)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP38117
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAELRVLVAVKRVIDYAVKIRVKPDRTGVV TDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALA MGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDD CNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAV VTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDP PQRTAGVKVETTEDLVAKLKEIGRI
    • Molecular weight30 kDa including tags
    • Amino acids1 to 255
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab107152 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Beta ETF
    • Beta-ETF
    • Electron transfer flavoprotein beta polypeptide
    • Electron transfer flavoprotein beta subunit
    • Electron transfer flavoprotein subunit beta
    • Electron transferring flavoprotein beta polypeptide
    • etfB
    • ETFB_HUMAN
    • FP585
    • MADD
    see all
  • FunctionThe electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).
  • Tissue specificityAbundant in liver, heart and skeletal muscle. A weak expression is seen in the brain, placenta, lung, kidney and pancreas.
  • Involvement in diseaseGlutaric aciduria 2B
  • Sequence similaritiesBelongs to the ETF beta-subunit/FixA family.
  • DomainThe recognition loop recognizes a hydrophobic patch at the surface of interacting dehydrogenases and acts as a static anchor at the interface.
  • Post-translational
    modifications
    Methylated. Trimethylation at Lys-200 and Lys-203 may negatively regulate the activity in electron transfer from Acyl-CoA dehydrogenases.
  • Cellular localizationMitochondrion matrix.
  • Information by UniProt

Recombinant Human ETFB protein images

  • 15% SDS-PAGE showing ab107152 (3µg).

References for Recombinant Human ETFB protein (ab107152)

ab107152 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

Both ab91685 and ab107152 are provided in denatured condition which does not needed to be refolded (renaturation).

I hope this information is helpful to you. Please do not hesitate to contact us if you ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"