Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNHKVHHHHHHMAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMN PFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHV EVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTA GFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNE PRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKV ETTEDLVAKL KEIGRI
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 255
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.48% HEPES, 0.88% Sodium chloride

General Info

  • Alternative names
    • Beta ETF
    • Beta-ETF
    • Electron transfer flavoprotein beta polypeptide
    • Electron transfer flavoprotein beta subunit
    • Electron transfer flavoprotein subunit beta
    • Electron transferring flavoprotein beta polypeptide
    • etfB
    • ETFB_HUMAN
    • FP585
    • MADD
    see all
  • Function
    The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).
  • Tissue specificity
    Abundant in liver, heart and skeletal muscle. A weak expression is seen in the brain, placenta, lung, kidney and pancreas.
  • Involvement in disease
    Glutaric aciduria 2B
  • Sequence similarities
    Belongs to the ETF beta-subunit/FixA family.
  • Domain
    The recognition loop recognizes a hydrophobic patch at the surface of interacting dehydrogenases and acts as a static anchor at the interface.
  • Post-translational
    modifications
    Methylated. Trimethylation at Lys-200 and Lys-203 may negatively regulate the activity in electron transfer from Acyl-CoA dehydrogenases.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

References

ab185394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up